| Product Number |
ARP58597_P050 |
| Product Page |
www.avivasysbio.com/bpnt1-antibody-n-terminal-region-arp58597-p050.html |
| Name |
BPNT1 Antibody - N-terminal region (ARP58597_P050) |
| Protein Size (# AA) |
261 amino acids |
| Molecular Weight |
29kDa |
| NCBI Gene Id |
10380 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
3'(2'), 5'-bisphosphate nucleotidase 1 |
| Alias Symbols |
PIP, HEL20 |
| Peptide Sequence |
Synthetic peptide located within the following region: DRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Spiegelberg,B.D., (1999) J. Biol. Chem. 274 (19), 13619-13628 |
| Description of Target |
BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity. |
| Protein Interactions |
SUMO2; UBC; IQCB1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-BPNT1 (ARP58597_P050) antibody |
| Blocking Peptide |
For anti-BPNT1 (ARP58597_P050) antibody is Catalog # AAP58597 (Previous Catalog # AAPP35814) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human BPNT1 |
| Uniprot ID |
O95861 |
| Protein Name |
3'(2'),5'-bisphosphate nucleotidase 1 |
| Protein Accession # |
NP_006076 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006085 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
BPNT1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 91% |
| Image 1 | Human MCF-7
 | WB Suggested Anti-BPNT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: MCF7 cell lysate |
|
|
