| Product Number |
ARP58590_P050 |
| Product Page |
www.avivasysbio.com/atp6v1e2-antibody-middle-region-arp58590-p050.html |
| Name |
ATP6V1E2 Antibody - middle region (ARP58590_P050) |
| Protein Size (# AA) |
226 amino acids |
| Molecular Weight |
26kDa |
| Subunit |
E 2 |
| NCBI Gene Id |
90423 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E2 |
| Alias Symbols |
VMA4, ATP6E1, ATP6EL2, ATP6V1EL2 |
| Peptide Sequence |
Synthetic peptide located within the following region: LMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hillier,L.W., (2005) Nature 434 (7034), 724-731 |
| Description of Target |
ATP6V1E2 is a subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. This isoform is essential for energy coupling involved in acidification of acrosome. |
| Protein Interactions |
C9orf16; ATP6V1G1; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ATP6V1E2 (ARP58590_P050) antibody |
| Blocking Peptide |
For anti-ATP6V1E2 (ARP58590_P050) antibody is Catalog # AAP58590 (Previous Catalog # AAPP35710) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ATP6V1E2 |
| Uniprot ID |
Q96A05 |
| Protein Name |
V-type proton ATPase subunit E 2 |
| Protein Accession # |
NP_542384 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_080653 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ATP6V1E2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 79%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Rabbit: 79%; Rat: 86%; Sheep: 79% |
| Image 1 | Human Spleen
 | WB Suggested Anti-ATP6V1E2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Spleen |
|
