XRCC2 Antibody - middle region (ARP58558_P050)

• Product Number: ARP58558_P050
• Name: XRCC2 Antibody - middle region (ARP58558_P050)
• Protein Size (# AA): 280 amino acids
• Molecular Weight: 31kDa
• NCBI Gene Id: 7516
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: X-ray repair complementing defective repair in Chinese hamster cells 2
• Alias Symbols: FANCU, POF17, SPGF50
• Peptide Sequence: Synthetic peptide located within the following region: CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Yen,C.Y., (2008) J. Oral Pathol. Med. 37 (5), 271-277
• Description of Target: XRCC2 is a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents.This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: RAD51D; MEOX2; WFDC1; NKIRAS1; UBC; RAD51B; RAD51C; RAD51; BLM;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-XRCC2 (ARP58558_P050) antibody is Catalog # AAP58558 (Previous Catalog # AAPP34583)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human XRCC2
• Uniprot ID: O43543
• Protein Name: DNA repair protein XRCC2
• Protein Accession #: NP_005422
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005431
• Tested Species Reactivity: Human
• Gene Symbol: XRCC2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 86%
• Image 1: Human Muscle
  
  WB Suggested Anti-XRCC2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human Muscle