SCRN2 Antibody - N-terminal region (ARP58525_P050)

Data Sheet
 
Product Number ARP58525_P050
Product Page www.avivasysbio.com/scrn2-antibody-n-terminal-region-arp58525-p050.html
Name SCRN2 Antibody - N-terminal region (ARP58525_P050)
Protein Size (# AA) 425 amino acids
Molecular Weight 47kDa
NCBI Gene Id 90507
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Secernin 2
Alias Symbols Ses2
Peptide Sequence Synthetic peptide located within the following region: MASSSPDSPCSCDCFVSVPPASAIPAVIFAKNSDRPRDEVQEVVFVPAGT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Way,G., (2002) Mol. Biol. Cell 13 (9), 3344-3354
Description of Target The exact function of SCRN2 remains unknown.
Protein Interactions TERF2IP; TINF2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SCRN2 (ARP58525_P050) antibody
Blocking Peptide For anti-SCRN2 (ARP58525_P050) antibody is Catalog # AAP58525 (Previous Catalog # AAPP34841)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SCRN2
Uniprot ID Q96FV2
Protein Name Secernin-2
Protein Accession # NP_612364
Purification Affinity Purified
Nucleotide Accession # NM_138355
Tested Species Reactivity Human
Gene Symbol SCRN2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human HepG2
WB Suggested Anti-SCRN2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com