| Product Number |
ARP58525_P050 |
| Product Page |
www.avivasysbio.com/scrn2-antibody-n-terminal-region-arp58525-p050.html |
| Name |
SCRN2 Antibody - N-terminal region (ARP58525_P050) |
| Protein Size (# AA) |
425 amino acids |
| Molecular Weight |
47kDa |
| NCBI Gene Id |
90507 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Secernin 2 |
| Alias Symbols |
Ses2 |
| Peptide Sequence |
Synthetic peptide located within the following region: MASSSPDSPCSCDCFVSVPPASAIPAVIFAKNSDRPRDEVQEVVFVPAGT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Way,G., (2002) Mol. Biol. Cell 13 (9), 3344-3354 |
| Description of Target |
The exact function of SCRN2 remains unknown. |
| Protein Interactions |
TERF2IP; TINF2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SCRN2 (ARP58525_P050) antibody |
| Blocking Peptide |
For anti-SCRN2 (ARP58525_P050) antibody is Catalog # AAP58525 (Previous Catalog # AAPP34841) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SCRN2 |
| Uniprot ID |
Q96FV2 |
| Protein Name |
Secernin-2 |
| Protein Accession # |
NP_612364 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_138355 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SCRN2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Human HepG2
 | WB Suggested Anti-SCRN2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate |
|
|
