SAMD8 Antibody - middle region : Biotin (ARP58524_P050-Biotin)

Data Sheet
 
Product Number ARP58524_P050-Biotin
Product Page www.avivasysbio.com/samd8-antibody-middle-region-biotin-arp58524-p050-biotin.html
Name SAMD8 Antibody - middle region : Biotin (ARP58524_P050-Biotin)
Protein Size (# AA) 326 amino acids
Molecular Weight 36kDa
Conjugation Biotin
NCBI Gene Id 142891
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Sterile alpha motif domain containing 8
Alias Symbols SMSr, HEL-177
Peptide Sequence Synthetic peptide located within the following region: MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference Jin,Y.J., (2005) Science 307 (5715), 1621-1625
Description of Target SAMD8 is a multi-pass membrane protein. It belongs to the sphingomyelin synthase family and contains 1 SAM (sterile alpha motif) domain. The function of the SAMD8 protein remains unknown.
Protein Interactions UBC; TGFBR1;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-SAMD8 (ARP58524_P050-Biotin) antibody
Blocking Peptide For anti-SAMD8 (ARP58524_P050-Biotin) antibody is Catalog # AAP58524 (Previous Catalog # AAPP34846)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SAMD8
Uniprot ID Q5JSC8
Protein Name Sphingomyelin synthase-related protein 1
Protein Accession # NP_653261
Purification Affinity Purified
Nucleotide Accession # NM_144660
Gene Symbol SAMD8
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com