| Product Number |
ARP58524_P050 |
| Product Page |
www.avivasysbio.com/samd8-antibody-middle-region-arp58524-p050.html |
| Name |
SAMD8 Antibody - middle region (ARP58524_P050) |
| Protein Size (# AA) |
326 amino acids |
| Molecular Weight |
36kDa |
| NCBI Gene Id |
142891 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Sterile alpha motif domain containing 8 |
| Alias Symbols |
SMSr, HEL-177 |
| Peptide Sequence |
Synthetic peptide located within the following region: MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Jin,Y.J., (2005) Science 307 (5715), 1621-1625 |
| Description of Target |
SAMD8 is a multi-pass membrane protein. It belongs to the sphingomyelin synthase family and contains 1 SAM (sterile alpha motif) domain. The function of the SAMD8 protein remains unknown. |
| Protein Interactions |
UBC; TGFBR1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SAMD8 (ARP58524_P050) antibody |
| Blocking Peptide |
For anti-SAMD8 (ARP58524_P050) antibody is Catalog # AAP58524 (Previous Catalog # AAPP34846) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SAMD8 |
| Uniprot ID |
Q5JSC8 |
| Protein Name |
Sphingomyelin synthase-related protein 1 |
| Protein Accession # |
NP_653261 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_144660 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SAMD8 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human Heart
 | WB Suggested Anti-SAMD8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart |
|
|
