RPL13A Antibody - middle region (ARP58522_P050)

Data Sheet
 
Product Number ARP58522_P050
Product Page www.avivasysbio.com/rpl13a-antibody-middle-region-arp58522-p050.html
Name RPL13A Antibody - middle region (ARP58522_P050)
Protein Size (# AA) 203 amino acids
Molecular Weight 22kDa
NCBI Gene Id 23521
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ribosomal protein L13a
Alias Symbols L13A, TSTA1
Peptide Sequence Synthetic peptide located within the following region: HEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hasegawa,K., (2008) Biochem. Biophys. Res. Commun. 372 (1), 51-56
Description of Target Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pro
Protein Interactions HUWE1; UBC; CEP250; TUBG1; ZBTB1; RPA3; RPA2; RPA1; EED; RNF2; Erbb3; TARDBP; ETS1; IGSF8; ICAM1; PAN2; ALG12; TP63; UBL4A; VTN; VCAM1; RPL30; ND1; ITGA4; FNTA; FN1; STOM; CYP2E1; CRP; ALDH2; EIF4A3; MAGOH; ESR1; CAND1; CUL1; CUL3; CUL5; NFX1; CALM1; NOP5
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RPL13A (ARP58522_P050) antibody
Blocking Peptide For anti-RPL13A (ARP58522_P050) antibody is Catalog # AAP58522 (Previous Catalog # AAPP34536)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RPL13A
Uniprot ID P40429
Protein Name 60S ribosomal protein L13a
Sample Type Confirmation

RPL13A is strongly supported by BioGPS gene expression data to be expressed in COLO205

Protein Accession # NP_036555
Purification Affinity Purified
Nucleotide Accession # NM_001752
Tested Species Reactivity Human
Gene Symbol RPL13A
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 86%; Zebrafish: 91%
Image 1
Human COLO205
WB Suggested Anti-RPL13A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: COLO205 cell lysateRPL13A is strongly supported by BioGPS gene expression data to be expressed in Human COLO205 cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com