Product Number |
ARP58515_P050 |
Product Page |
www.avivasysbio.com/pnpo-antibody-n-terminal-region-arp58515-p050.html |
Name |
PNPO Antibody - N-terminal region (ARP58515_P050) |
Protein Size (# AA) |
261 amino acids |
Molecular Weight |
29kDa |
NCBI Gene Id |
55163 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Pyridoxamine 5'-phosphate oxidase |
Alias Symbols |
PDXPO, HEL-S-302 |
Peptide Sequence |
Synthetic peptide located within the following region: PMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLAT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Song,H., Schizophr. Res. 97 (1-3), 264-270 (2007) |
Description of Target |
PNPO catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5'-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine.Vitamin B6, or pyridoxal 5-prime-phosphate (PLP), is critical for normal cellular function, and some cancer cells have notable differences in vitamin B6 metabolism compared to their normal counterparts. The rate-limiting enzyme in vitamin B6 synthesis is pyridoxine-5-prime-phosphate (PNP) oxidase (PNPO; EC 1.4.3.5).[supplied by OMIM]. |
Protein Interactions |
UBC; LPP; APP; ELAVL1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PNPO (ARP58515_P050) antibody |
Blocking Peptide |
For anti-PNPO (ARP58515_P050) antibody is Catalog # AAP58515 (Previous Catalog # AAPP34535) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PNPO |
Uniprot ID |
Q9NVS9 |
Protein Name |
Pyridoxine-5'-phosphate oxidase |
Protein Accession # |
NP_060599 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_018129 |
Tested Species Reactivity |
Human |
Gene Symbol |
PNPO |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | Human Muscle
| WB Suggested Anti-PNPO Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Muscle |
|
Image 2 | Human Liver
| Rabbit Anti-PNPO antibody Catalog Number: ARP58515 Formalin Fixed Paraffin Embedded Tissue: Human Liver Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec
|
|