PNPO Antibody - N-terminal region (ARP58515_P050)

Data Sheet
 
Product Number ARP58515_P050
Product Page www.avivasysbio.com/pnpo-antibody-n-terminal-region-arp58515-p050.html
Name PNPO Antibody - N-terminal region (ARP58515_P050)
Protein Size (# AA) 261 amino acids
Molecular Weight 29kDa
NCBI Gene Id 55163
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Pyridoxamine 5'-phosphate oxidase
Alias Symbols PDXPO, HEL-S-302
Peptide Sequence Synthetic peptide located within the following region: PMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLAT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Song,H., Schizophr. Res. 97 (1-3), 264-270 (2007)
Description of Target PNPO catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5'-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine.Vitamin B6, or pyridoxal 5-prime-phosphate (PLP), is critical for normal cellular function, and some cancer cells have notable differences in vitamin B6 metabolism compared to their normal counterparts. The rate-limiting enzyme in vitamin B6 synthesis is pyridoxine-5-prime-phosphate (PNP) oxidase (PNPO; EC 1.4.3.5).[supplied by OMIM].
Protein Interactions UBC; LPP; APP; ELAVL1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PNPO (ARP58515_P050) antibody
Blocking Peptide For anti-PNPO (ARP58515_P050) antibody is Catalog # AAP58515 (Previous Catalog # AAPP34535)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PNPO
Uniprot ID Q9NVS9
Protein Name Pyridoxine-5'-phosphate oxidase
Protein Accession # NP_060599
Purification Affinity Purified
Nucleotide Accession # NM_018129
Tested Species Reactivity Human
Gene Symbol PNPO
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human Muscle
WB Suggested Anti-PNPO Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle
Image 2
Human Liver
Rabbit Anti-PNPO antibody
Catalog Number: ARP58515
Formalin Fixed Paraffin Embedded Tissue: Human Liver
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com