| Product Number |
ARP58514_P050 |
| Product Page |
www.avivasysbio.com/plxna4-antibody-middle-region-arp58514-p050.html |
| Name |
PLXNA4 Antibody - middle region (ARP58514_P050) |
| Protein Size (# AA) |
522 amino acids |
| Molecular Weight |
57kDa |
| NCBI Gene Id |
91584 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Plexin A4 |
| Alias Symbols |
PLEXA4, PLXNA4A, PLXNA4B, FAYV2820, PRO34003 |
| Peptide Sequence |
Synthetic peptide located within the following region: TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270 |
| Description of Target |
This protein mediates semaphorin receptor activity. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PLXNA4 (ARP58514_P050) antibody |
| Blocking Peptide |
For anti-PLXNA4 (ARP58514_P050) antibody is Catalog # AAP58514 (Previous Catalog # AAPP34821) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PLXNA4 |
| Uniprot ID |
A4D1N6 |
| Protein Name |
Plexin A4, B, isoform CRA_a EMBL EAW83793.1 |
| Protein Accession # |
NP_861440 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_181775 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PLXNA4 |
| Predicted Species Reactivity |
Human, Yeast |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Yeast: 90% |
| Image 1 | Human HepG2
 | WB Suggested Anti-PLXNA4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate |
|
|
