| Product Number |
ARP58512_P050 |
| Product Page |
www.avivasysbio.com/pef1-antibody-middle-region-arp58512-p050.html |
| Name |
PEF1 Antibody - middle region (ARP58512_P050) |
| Protein Size (# AA) |
284 amino acids |
| Molecular Weight |
31kDa |
| NCBI Gene Id |
553115 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Penta-EF-hand domain containing 1 |
| Alias Symbols |
ABP32, PEF1A |
| Peptide Sequence |
Synthetic peptide located within the following region: WKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Jordanova,A., (2006) Nat. Genet. 38 (2), 197-202 |
| Description of Target |
PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit (CAPNS1; MIM 114170), sorcin (SRI; MIM 182520), grancalcin (GCA; MIM 607030), and ALG2.PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit (CAPNS1; MIM 114170), sorcin (SRI; MIM 182520), grancalcin (GCA; MIM 607030), and ALG2 (PDCD6; MIM 601057) (Kitaura et al., 2001 [PubMed 11278427]).[supplied by OMIM]. Sequence Note: removed 1 base from the 3' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1640 AB026628.1 1-1640 |
| Protein Interactions |
FOXR2; KLHL12; CEP55; TFG; CALCOCO2; PDCD6; HGS; EWSR1; UBC; BAG3; DAZAP2; NR0B2; PDCD6IP; LAMTOR3; CUL3; H2AFX; ALG2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PEF1 (ARP58512_P050) antibody |
| Blocking Peptide |
For anti-PEF1 (ARP58512_P050) antibody is Catalog # AAP58512 (Previous Catalog # AAPP34820) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PEF1 |
| Uniprot ID |
Q9UBV8 |
| Protein Name |
Peflin |
| Sample Type Confirmation |
PEF1 is supported by BioGPS gene expression data to be expressed in 721_B |
| Protein Accession # |
NP_036524 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_012392 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PEF1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%; Zebrafish: 91% |
| Image 1 | Human 721_B
 | WB Suggested Anti-PEF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysatePEF1 is supported by BioGPS gene expression data to be expressed in 721_B |
|
