| Product Number |
ARP58501_P050 |
| Product Page |
www.avivasysbio.com/nmbr-antibody-n-terminal-region-arp58501-p050.html |
| Name |
NMBR Antibody - N-terminal region (ARP58501_P050) |
| Protein Size (# AA) |
390 amino acids |
| Molecular Weight |
43kDa |
| NCBI Gene Id |
4829 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Neuromedin B receptor |
| Alias Symbols |
BB1, BB1R, NMB-R |
| Peptide Sequence |
Synthetic peptide located within the following region: PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Matusiak,D., Am. J. Physiol. Gastrointest. Liver Physiol. 288 (4), G718-G728 |
| Description of Target |
Neuromedin B receptor binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissue.Neuromedin B receptor binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissue. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because transcript sequence consistent with the reference genome assembly was not available for all regions of the RefSeq transcript. The extent of this transcript is supported by transcript alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-100 AL589674.9 90178-90277 c 101-1308 M73482.1 99-1306 1309-1354 AL589674.9 77086-77131 c This locus represents an antisense transcript of the survivin locus. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-270 AF086186.1 11-280 271-869 AC087645.19 118062-118660 870-1098 L26245.1 740-968 1099-1286 BM839824.1 1-188 c |
| Protein Interactions |
NMB; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NMBR (ARP58501_P050) antibody |
| Blocking Peptide |
For anti-NMBR (ARP58501_P050) antibody is Catalog # AAP58501 (Previous Catalog # AAPP34815) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NMBR |
| Uniprot ID |
P28336 |
| Protein Name |
Neuromedin-B receptor |
| Protein Accession # |
NP_002502 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_002511 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NMBR |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Brain
 | WB Suggested Anti-NMBR Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain |
|
|
