| Product Number |
ARP58497_P050 |
| Product Page |
www.avivasysbio.com/ms4a4a-antibody-n-terminal-region-arp58497-p050.html |
| Name |
MS4A4A Antibody - N-terminal region (ARP58497_P050) |
| Protein Size (# AA) |
239 amino acids |
| Molecular Weight |
26kDa |
| NCBI Gene Id |
51338 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Membrane-spanning 4-domains, subfamily A, member 4A |
| Alias Symbols |
MS4A4, MS4A7, 4SPAN1, CD20L1, CD20-L1, HDCME31P |
| Peptide Sequence |
Synthetic peptide located within the following region: MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Liang,Y., (2001) Immunogenetics 53 (5), 357-368 |
| Description of Target |
MS4A4A is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues.This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. Alternative splicing of this gene results in several transcript variants; however, not all transcripts have been fully described. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MS4A4A (ARP58497_P050) antibody |
| Blocking Peptide |
For anti-MS4A4A (ARP58497_P050) antibody is Catalog # AAP58497 (Previous Catalog # AAPP34843) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MS4A4A |
| Uniprot ID |
Q96JQ5 |
| Protein Name |
Membrane-spanning 4-domains subfamily A member 4A |
| Protein Accession # |
NP_683876 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_148975 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MS4A4A |
| Predicted Species Reactivity |
Human, Rat |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Rat: 86% |
| Image 1 | Human 721_B
 | WB Suggested Anti-MS4A4A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate |
|
|
