| Product Number |
ARP58494_P050 |
| Product Page |
www.avivasysbio.com/mindy4b-antibody-middle-region-arp58494-p050.html |
| Name |
MINDY4B Antibody - middle region (ARP58494_P050) |
| Protein Size (# AA) |
460 amino acids |
| Molecular Weight |
51kDa |
| NCBI Gene Id |
646951 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
MINDY family member 4B |
| Alias Symbols |
C3orf76, FAM188B2 |
| Peptide Sequence |
Synthetic peptide located within the following region: SQETLHGVLTRSDVGYLQWGKDASEDDRLSQVGSMLKTPKLPIWLCNING |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MINDY4B (ARP58494_P050) antibody |
| Blocking Peptide |
For anti-MINDY4B (ARP58494_P050) antibody is Catalog # AAP58494 (Previous Catalog # AAPP34714) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LOC646951 |
| Uniprot ID |
A8MYZ0 |
| Protein Name |
inactive ubiquitin carboxyl-terminal hydrolase MINDY-4B |
| Protein Accession # |
XP_935009 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
XM_929916 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MINDY4B |
| Predicted Species Reactivity |
Human, Cow, Dog, Guinea Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 93%; Guinea Pig: 77%; Human: 100%; Rabbit: 93% |
| Image 1 | Human OVCAR-3
 | WB Suggested Anti-FAM188B2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysate |
|
|
