Product Number |
ARP58490_P050 |
Product Page |
www.avivasysbio.com/lcn8-antibody-n-terminal-region-arp58490-p050.html |
Name |
LCN8 Antibody - N-terminal region (ARP58490_P050) |
Protein Size (# AA) |
152 amino acids |
Molecular Weight |
17kDa |
NCBI Gene Id |
138307 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Lipocalin 8 |
Alias Symbols |
EP17, LCN5 |
Peptide Sequence |
Synthetic peptide located within the following region: EELDRQKIGGFWREVGVASDQSLVLTAPKRVEGLFLTLSGSNLTVKVAYN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Suzuki,K., Gene 339, 49-59 (2004) |
Description of Target |
The exact function of LCN8 is not known. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-LCN8 (ARP58490_P050) antibody |
Blocking Peptide |
For anti-LCN8 (ARP58490_P050) antibody is Catalog # AAP58490 (Previous Catalog # AAPP34722) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LCN8 |
Uniprot ID |
A1L4A8 |
Protein Name |
Epididymal-specific lipocalin-8 |
Protein Accession # |
NP_848564 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_178469 |
Tested Species Reactivity |
Human |
Gene Symbol |
LCN8 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human 721_B
| WB Suggested Anti-LCN8 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: 721_B cell lysate |
|
|