| Product Number |
ARP58490_P050 |
| Product Page |
www.avivasysbio.com/lcn8-antibody-n-terminal-region-arp58490-p050.html |
| Name |
LCN8 Antibody - N-terminal region (ARP58490_P050) |
| Protein Size (# AA) |
152 amino acids |
| Molecular Weight |
17kDa |
| NCBI Gene Id |
138307 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Lipocalin 8 |
| Alias Symbols |
EP17, LCN5 |
| Peptide Sequence |
Synthetic peptide located within the following region: EELDRQKIGGFWREVGVASDQSLVLTAPKRVEGLFLTLSGSNLTVKVAYN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Suzuki,K., Gene 339, 49-59 (2004) |
| Description of Target |
The exact function of LCN8 is not known. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LCN8 (ARP58490_P050) antibody |
| Blocking Peptide |
For anti-LCN8 (ARP58490_P050) antibody is Catalog # AAP58490 (Previous Catalog # AAPP34722) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LCN8 |
| Uniprot ID |
A1L4A8 |
| Protein Name |
Epididymal-specific lipocalin-8 |
| Protein Accession # |
NP_848564 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_178469 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LCN8 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human 721_B
 | WB Suggested Anti-LCN8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate |
|
|
