LCN12 Antibody - N-terminal region (ARP58489_P050)

Data Sheet
 
Product Number ARP58489_P050
Product Page www.avivasysbio.com/lcn12-antibody-n-terminal-region-arp58489-p050.html
Name LCN12 Antibody - N-terminal region (ARP58489_P050)
Protein Size (# AA) 355 amino acids
Molecular Weight 39kDa
NCBI Gene Id 286256
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Lipocalin 12
Alias Symbols MGC34753, MGC48935
Peptide Sequence Synthetic peptide located within the following region: GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Suzuki,K., Gene 339, 49-59 (2004)
Description of Target LCN12 may play a role in male fertility. LCN12 may act as a retinoid carrier protein within the epididymis.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LCN12 (ARP58489_P050) antibody
Blocking Peptide For anti-LCN12 (ARP58489_P050) antibody is Catalog # AAP58489 (Previous Catalog # AAPP34572)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LCN12
Uniprot ID Q8IW14
Protein Name LCN12 protein EMBL AAH41168.1
Protein Accession # NP_848631
Purification Affinity Purified
Nucleotide Accession # NM_178536
Tested Species Reactivity Human
Gene Symbol LCN12
Predicted Species Reactivity Human, Mouse
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Mouse: 79%
Image 1
Human Heart
WB Suggested Anti-LCN12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com