Product Number |
ARP58489_P050 |
Product Page |
www.avivasysbio.com/lcn12-antibody-n-terminal-region-arp58489-p050.html |
Name |
LCN12 Antibody - N-terminal region (ARP58489_P050) |
Protein Size (# AA) |
355 amino acids |
Molecular Weight |
39kDa |
NCBI Gene Id |
286256 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Lipocalin 12 |
Alias Symbols |
MGC34753, MGC48935 |
Peptide Sequence |
Synthetic peptide located within the following region: GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Suzuki,K., Gene 339, 49-59 (2004) |
Description of Target |
LCN12 may play a role in male fertility. LCN12 may act as a retinoid carrier protein within the epididymis. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-LCN12 (ARP58489_P050) antibody |
Blocking Peptide |
For anti-LCN12 (ARP58489_P050) antibody is Catalog # AAP58489 (Previous Catalog # AAPP34572) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LCN12 |
Uniprot ID |
Q8IW14 |
Protein Name |
LCN12 protein EMBL AAH41168.1 |
Protein Accession # |
NP_848631 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_178536 |
Tested Species Reactivity |
Human |
Gene Symbol |
LCN12 |
Predicted Species Reactivity |
Human, Mouse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100%; Mouse: 79% |
Image 1 | Human Heart
| WB Suggested Anti-LCN12 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human heart |
|
|