| Product Number |
ARP58488_P050 |
| Product Page |
www.avivasysbio.com/kptn-antibody-n-terminal-region-arp58488-p050.html |
| Name |
KPTN Antibody - N-terminal region (ARP58488_P050) |
| Protein Size (# AA) |
436 amino acids |
| Molecular Weight |
47kDa |
| NCBI Gene Id |
11133 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Kaptin (actin binding protein) |
| Alias Symbols |
2E4, KICS4, MRT41 |
| Peptide Sequence |
Synthetic peptide located within the following region: MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007) |
| Description of Target |
KPTN may be involved in actin dynamics. KPTN may play a role in producing the sensory apparatus in hair cells. KPTN may also play a role in actin rearrangements that accompany platelet activation and stereocilia formation. |
| Protein Interactions |
SRPK1; APP; ACTC1; RAB25; ITFG2; PKIG; TSPAN7; AUP1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KPTN (ARP58488_P050) antibody |
| Blocking Peptide |
For anti-KPTN (ARP58488_P050) antibody is Catalog # AAP58488 (Previous Catalog # AAPP34571) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human KPTN |
| Uniprot ID |
Q9Y664 |
| Protein Name |
Kaptin |
| Protein Accession # |
NP_008990 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_007059 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KPTN |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77% |
| Image 1 | Human HepG2
 | WB Suggested Anti-KPTN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
|
|
