| Product Number |
ARP58487_P050 |
| Product Page |
www.avivasysbio.com/klhl15-antibody-middle-region-arp58487-p050.html |
| Name |
KLHL15 Antibody - middle region (ARP58487_P050) |
| Protein Size (# AA) |
604 amino acids |
| Molecular Weight |
66kDa |
| NCBI Gene Id |
80311 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Kelch-like 15 (Drosophila) |
| Alias Symbols |
HEL-S-305 |
| Peptide Sequence |
Synthetic peptide located within the following region: VLDKQIMVLGGLCYNGHYSDSILTFDPDENKWKEDEYPRMPCKLDGLQVC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004) |
| Description of Target |
KLHL15 is a member of the kelch-like family of proteins that share a common domain structure consisting of an N-terminal broad-complex, tramtrack, bric-a-brac/poxvirus and zinc finger domain and C-terminal kelch repeat motifs. KLHL15 may be involved in protein ubiquitination and cytoskeletal organization. |
| Protein Interactions |
UBC; HSP90AA1; KLHL15; CUL3; PPP2R2B; PPP2R1A; PPP2CA; DCUN1D1; COPS5; COPS6; CUL5; NEDD8; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KLHL15 (ARP58487_P050) antibody |
| Blocking Peptide |
For anti-KLHL15 (ARP58487_P050) antibody is Catalog # AAP58487 (Previous Catalog # AAPP34803) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human KLHL15 |
| Uniprot ID |
Q96M94 |
| Protein Name |
Kelch-like protein 15 |
| Protein Accession # |
NP_085127 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_030624 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KLHL15 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Human 293T
 | WB Suggested Anti-KLHL15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate |
|
|
