GNA15 Antibody - N-terminal region (ARP58472_P050)

Data Sheet
 
Product Number ARP58472_P050
Product Page www.avivasysbio.com/gna15-antibody-n-terminal-region-arp58472-p050.html
Name GNA15 Antibody - N-terminal region (ARP58472_P050)
Protein Size (# AA) 374 amino acids
Molecular Weight 41kDa
Subunit alpha-15
NCBI Gene Id 2769
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Guanine nucleotide binding protein (G protein), alpha 15 (Gq class)
Alias Symbols GNA16
Peptide Sequence Synthetic peptide located within the following region: ARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Johansson,B.B., (2005) FEBS J. 272 (20), 5365-5377
Description of Target GNA15 belongs to the G-alpha family. Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
Protein Interactions APP; UBC; TTC1; HRH4; CNR2; GRM4; GRM2; LTB4R; RGS2; OPRM1; F2R; PRKCA; OPRK1; OPRD1; CXCR1; CXCR2; CHRM2; CNR1; ADRB2; ADRBK1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GNA15 (ARP58472_P050) antibody
Blocking Peptide For anti-GNA15 (ARP58472_P050) antibody is Catalog # AAP58472 (Previous Catalog # AAPP34737)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GNA15
Uniprot ID P30679
Protein Name Guanine nucleotide-binding protein subunit alpha-15
Protein Accession # NP_002059
Purification Affinity Purified
Nucleotide Accession # NM_002068
Tested Species Reactivity Human
Gene Symbol GNA15
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rat: 93%
Image 1
Human Liver
WB Suggested Anti-GNA15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com