| Product Number |
ARP58463_P050 |
| Product Page |
www.avivasysbio.com/fbxo27-antibody-middle-region-arp58463-p050.html |
| Name |
FBXO27 Antibody - middle region (ARP58463_P050) |
| Protein Size (# AA) |
283 amino acids |
| Molecular Weight |
31kDa |
| NCBI Gene Id |
126433 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
F-box protein 27 |
| Alias Symbols |
FBG5, Fbx27 |
| Peptide Sequence |
Synthetic peptide located within the following region: LDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Jin,J., (2004) Genes Dev. 18 (21), 2573-2580 |
| Description of Target |
Members of the F-box protein family, such as FBXO27, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO27, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM]. |
| Protein Interactions |
CLN5; HSP90AA1; RBX1; CUL1; SKP1; ELAVL1; MGMT; STUB1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FBXO27 (ARP58463_P050) antibody |
| Blocking Peptide |
For anti-FBXO27 (ARP58463_P050) antibody is Catalog # AAP58463 (Previous Catalog # AAPP34736) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human FBXO27 |
| Uniprot ID |
Q8NI29 |
| Protein Name |
F-box only protein 27 |
| Protein Accession # |
NP_849142 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_178820 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FBXO27 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 83% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-FBXO27 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate |
|
|
