EPHA5 Antibody - middle region (ARP58460_P050)

• Product Number: ARP58460_P050
• Name: EPHA5 Antibody - middle region (ARP58460_P050)
• Protein Size (# AA): 1037 amino acids
• Molecular Weight: 114kDa
• NCBI Gene Id: 2044
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: EPH receptor A5
• Alias Symbols: EK7, CEK7, EHK1, HEK7, EHK-1, TYRO4
• Peptide Sequence: Synthetic peptide located within the following region: SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)
• Description of Target: EPHA5 belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Two transcript variants encoding different isoforms have been found for this gene.This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.
• Protein Interactions: NEDD4; UBC; EFNA2; EFNA5; EFNA3; EFNA4; EFNA1; STAT3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-EPHA5 (ARP58460_P050) antibody is Catalog # AAP58460 (Previous Catalog # AAPP34721)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EPHA5
• Uniprot ID: P54756
• Protein Name: Ephrin type-A receptor 5
• Protein Accession #: NP_004430
• Purification: Affinity Purified
• Nucleotide Accession #: NM_004439
• Tested Species Reactivity: Human
• Gene Symbol: EPHA5
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human Brain
  
  WB Suggested Anti-EPHA5 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Human brain
• Image 2: Human Jurkat Whole Cell
  
  Host: Rabbit
  Target Name: EPHA5
  Sample Tissue: Human Jurkat Whole Cell
  Antibody Dilution: 1ug/ml