CPE Antibody - N-terminal region (ARP58445_P050)

• Product Number: ARP58445_P050
• Name: CPE Antibody - N-terminal region (ARP58445_P050)
• Protein Size (# AA): 476 amino acids
• Molecular Weight: 52kDa
• NCBI Gene Id: 1363
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Carboxypeptidase E
• Alias Symbols: CPH
• Peptide Sequence: Synthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Wang,J., (2008) Acta Pharmacol. Sin. 29 (6), 736-744
• Description of Target: CPE is a carboxypeptidase that cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. It is a peripheral membrane protein. The protein specifically binds regulated secretory pathway proteins, including prohormones, but not constitutively secreted proteinsThis gene encodes a carboxypeptidase that cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. It is a peripheral membrane protein. The protein specifically binds regulated secretory pathway proteins, including prohormones, but not constitutively secreted proteins. Mutations in this gene are implicated in type II diabetes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: PRKAA1; UBC; LRIF1; POLDIP2; MED31; ROBO2; POLA2; CHD3; TRH; NTS; GTF3C1; UTP14A; RPA1; PMCH; INS; GCG; GAST; CCK; BDNF;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CPE (ARP58445_P050) antibody is Catalog # AAP58445 (Previous Catalog # AAPP34556)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CPE
• Uniprot ID: P16870
• Protein Name: Carboxypeptidase E
• Sample Type Confirmation:

  CPE is strongly supported by BioGPS gene expression data to be expressed in HepG2

  CPE is supported by BioGPS gene expression data to be expressed in MCF7

• Protein Accession #: NP_001864
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001873
• Tested Species Reactivity: Human
• Gene Symbol: CPE
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
• Image 1: Human Brain
  
  Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5ug/ml using anti-CPE antibody (ARP58445_P050)
• Image 2: Human Pineal Tissue
  
  Rabbit Anti-CPE Antibody
  Catalog Number: ARP58445_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
  Observed Staining: Cytoplasmic in cell bodies and processes of pinealocytes
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: 1/600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
  
• Image 3: Human Fetal Lung
  
  Host: Rabbit
  Target Name: CPE
  Sample Type: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml
• Image 4: Human Fetal Heart
  
  Host: Rabbit
  Target Name: CPE
  Sample Type: Human Fetal Heart
  Antibody Dilution: 1.0ug/ml
• Image 5: Human MCF7
  
  WB Suggested Anti-CPE Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: MCF7 cell lysateCPE is supported by BioGPS gene expression data to be expressed in MCF7
• Image 6: Human HepG2
  
  Host: Rabbit
  Target Name: CPE
  Sample Type: HepG2
  Antibody Dilution: 1.0ug/mlCPE is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells