| Product Number |
ARP58440_P050 |
| Product Page |
www.avivasysbio.com/cd5-antibody-n-terminal-region-arp58440-p050.html |
| Name |
CD5 Antibody - N-terminal region (ARP58440_P050) |
| Protein Size (# AA) |
495 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
921 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
CD5 molecule |
| Alias Symbols |
T1, LEU1 |
| Peptide Sequence |
Synthetic peptide located within the following region: MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Siderovski,D.P., (2008) J. Mol. Biol. 378 (1), 129-144 |
| Description of Target |
CD5 may act as a receptor in regulating T-cell proliferation. CD5 interacts with CD72/LYB-2. |
| Protein Interactions |
VAV1; CBL; Prkcg; Prkca; CSNK2A1; Prkcb; LCK; FYN; CAMK2D; HNRNPU; DYNLT3; CD2; CD4; CD247; CD6; ZAP70; PTPN6; PIK3R1; CD79B; RASA1; CD79A; CD72; CD27; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CD5 (ARP58440_P050) antibody |
| Blocking Peptide |
For anti-CD5 (ARP58440_P050) antibody is Catalog # AAP58440 (Previous Catalog # AAPP34733) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CD5 |
| Uniprot ID |
P06127 |
| Protein Name |
T-cell surface glycoprotein CD5 |
| Protein Accession # |
NP_055022 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_014207 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CD5 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human COLO205
 | WB Suggested Anti-CD5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: COLO205 cell lysate |
|
|
