| Product Number |
ARP58438_P050 |
| Product Page |
www.avivasysbio.com/ccdc74a-antibody-middle-region-arp58438-p050.html |
| Name |
CCDC74A Antibody - C-terminal region (ARP58438_P050) |
| Protein Size (# AA) |
378 amino acids |
| Molecular Weight |
42kDa |
| NCBI Gene Id |
90557 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Coiled-coil domain containing 74A |
| Alias Symbols |
FLJ40345, CCDC74AV2, CCDC74AV3 |
| Peptide Sequence |
Synthetic peptide located within the following region: FPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hillier,L.W., (2005) Nature 434 (7034), 724-731 |
| Description of Target |
The exact function of CCDC74A remains unknown. |
| Protein Interactions |
KDM1A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CCDC74A (ARP58438_P050) antibody |
| Blocking Peptide |
For anti-CCDC74A (ARP58438_P050) antibody is Catalog # AAP58438 (Previous Catalog # AAPP34684) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CCDC74A |
| Uniprot ID |
Q96AQ1 |
| Protein Name |
Coiled-coil domain-containing protein 74A |
| Protein Accession # |
NP_620125 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_138770 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CCDC74A |
| Predicted Species Reactivity |
Human, Mouse, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 86% |
| Image 1 | Human MCF-7
 | WB Suggested Anti-CCDC74A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate |
|
|
