C1orf142 Antibody - middle region (ARP58429_P050)

• Product Number: ARP58429_P050
• Name: C1orf142 Antibody - middle region (ARP58429_P050)
• Protein Size (# AA): 464 amino acids
• Molecular Weight: 51kDa
• NCBI Gene Id: 116841
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Synaptosomal-associated protein, 47kDa
• Alias Symbols: SVAP1, HEL170, SNAP-47, C1orf142, ESFI5812, HEL-S-290
• Peptide Sequence: Synthetic peptide located within the following region: TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Deloukas,P., (2004) Nature 429 (6990), 375-381
• Description of Target: The function of this protein remains unknown.
• Protein Interactions: CEP57L1; FAM9B; KLC3; FATE1; MID2; SPAG5; STX4; MAGEA6; GOLGA2; UBC; UBD;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SNAP47 (ARP58429_P050) antibody is Catalog # AAP58429 (Previous Catalog # AAPP34516)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf142
• Uniprot ID: Q5SQN1
• Protein Name: Synaptosomal-associated protein 47
• Protein Accession #: NP_444280
• Purification: Affinity Purified
• Nucleotide Accession #: NM_138812
• Tested Species Reactivity: Human
• Gene Symbol: SNAP47
• Predicted Species Reactivity: Human, Cow, Horse, Pig, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Horse: 86%; Human: 100%; Pig: 92%; Rabbit: 86%; Zebrafish: 92%
• Image 1: Human PANC1
  
  WB Suggested Anti-C1orf142 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:12500
  Positive Control: PANC1 cell lysate