| Product Number |
ARP58417_P050 |
| Product Page |
www.avivasysbio.com/aldh1b1-antibody-middle-region-arp58417-p050.html |
| Name |
ALDH1B1 Antibody - middle region (ARP58417_P050) |
| Protein Size (# AA) |
517 amino acids |
| Molecular Weight |
57kDa |
| NCBI Gene Id |
219 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Aldehyde dehydrogenase 1 family, member B1 |
| Alias Symbols |
ALDH5, ALDHX |
| Peptide Sequence |
Synthetic peptide located within the following region: GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Luo,P., (2007) Stem Cells 25 (10), 2628-2637 |
| Description of Target |
ALDH1B1 belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems. |
| Protein Interactions |
UBC; TATDN1; OGFOD1; UBR7; PDCD10; HEXB; FH; EXOSC10; XRN2; FN1; FABP2; ECT2; UQCRB; FBXO6; CUL3; MYC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ALDH1B1 (ARP58417_P050) antibody |
| Blocking Peptide |
For anti-ALDH1B1 (ARP58417_P050) antibody is Catalog # AAP58417 (Previous Catalog # AAPP34845) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ALDH1B1 |
| Uniprot ID |
P30837 |
| Protein Name |
Aldehyde dehydrogenase X, mitochondrial |
| Sample Type Confirmation |
ALDH1B1 is supported by BioGPS gene expression data to be expressed in HeLa |
| Protein Accession # |
NP_000683 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000692 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ALDH1B1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 85%; Horse: 79%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 91%; Zebrafish: 85% |
| Image 1 | Human HeLa
 | WB Suggested Anti-ALDH1B1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysateALDH1B1 is supported by BioGPS gene expression data to be expressed in HeLa |
|
| Image 2 | human hepatocytes
 | WB Suggested Anti-ALDH1B1 Antibody
Positive Control: Lane1: 30ug human hepatocytes
Primary Antibody Dilution : 1:1000
Secondary Antibody : Anti-rabbit-HRP
Secondry Antibody Dilution : 1:5000
Submitted by: Takeshi Saito, USC Keck School of Medicine |
|
