Product Number |
ARP58414_P050 |
Product Page |
www.avivasysbio.com/actr1a-antibody-middle-region-arp58414-p050.html |
Name |
ACTR1A Antibody - middle region (ARP58414_P050) |
Protein Size (# AA) |
376 amino acids |
Molecular Weight |
41kDa |
NCBI Gene Id |
10121 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) |
Alias Symbols |
ARP1, Arp1A, CTRN1 |
Peptide Sequence |
Synthetic peptide located within the following region: AIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Sugarbaker,D.J., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (9), 3521-3526 |
Description of Target |
ACTR1A is a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin.This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Protein Interactions |
HUWE1; SUMO2; UBC; NUP133; DCTN4; MYCBP; DCTN3; DCTN2; ACTR1B; LMNB1; COG3; ACTR10; SMURF1; RRS1; PSMD1; PSMC4; MYH9; MCM7; COPS5; CUL1; CUL3; SUMO1; Cep76; Actr1a; Dctn1; Capza1; HDAC6; SPTBN2; SPTBN1; NUMA1; BICD2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ACTR1A (ARP58414_P050) antibody |
Blocking Peptide |
For anti-ACTR1A (ARP58414_P050) antibody is Catalog # AAP58414 (Previous Catalog # AAPP34545) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ACTR1A |
Uniprot ID |
P61163 |
Protein Name |
Alpha-centractin |
Protein Accession # |
NP_005727 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_005736 |
Tested Species Reactivity |
Human |
Gene Symbol |
ACTR1A |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human MCF-7
| WB Suggested Anti-ACTR1A Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: MCF7 cell lysate |
|
|