JMJD2B Antibody - middle region (ARP58398_P050)

Data Sheet
 
Product Number ARP58398_P050
Product Page www.avivasysbio.com/jmjd2b-antibody-middle-region-arp58398-p050.html
Name JMJD2B Antibody - middle region (ARP58398_P050)
Protein Size (# AA) 1096 amino acids
Molecular Weight 122kDa
NCBI Gene Id 23030
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Lysine (K)-specific demethylase 4B
Alias Symbols JMJD2B, TDRD14B
Peptide Sequence Synthetic peptide located within the following region: CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Katoh,Y. (2007) Int. J. Mol. Med. 20 (2), 269-273
Description of Target JMJD2 family proteins are classified into one group with JD2H and TUDOR domains and another group without JD2H or TUDOR domains. Because JMJD2C gene (also known as GASC1 gene) is amplified in esophageal squamous cell carcinoma (ESCC), JMJD2 family genes are cancer-associated genes. Human genes corresponding to KIAA0677, KIAA0876, KIAA0780 and FLJ10251 cDNAs were designated JMJD2A, JMJD2B, JMJD2C, and JMJD2D, respectively. In addition, JMJD2D homologous genes within human genome sequences AP002383.3 and AP001264.4 were designated JMJD2E and JMJD2F, respectively. C2HC2HC2- and C5HC2-type Cys (His) clusters were identified as the region conserved among JMJD2A (1064 aa), JMJD2B (1096 aa), and JMJD2C (1056 aa) proteins. JMJD2A, JMJD2B and JMJD2C consist of JmjN, JmjC, JD2H, and two TUDOR domains.
Protein Interactions UBC; H3F3C; HSP90B1; HSP90AA2P; SMU1; KMT2C; WDR5; ASH2L; KMT2D; RBBP5; HSPA4; HNRNPU; ESR1; MED10;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KDM4B (ARP58398_P050) antibody
Blocking Peptide For anti-KDM4B (ARP58398_P050) antibody is Catalog # AAP58398 (Previous Catalog # AAPP33407)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human JMJD2B
Uniprot ID O94953
Protein Name Lysine-specific demethylase 4B
Protein Accession # NP_055830
Purification Affinity Purified
Nucleotide Accession # NM_015015
Tested Species Reactivity Human
Gene Symbol KDM4B
Predicted Species Reactivity Human, Dog, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 92%; Horse: 92%; Human: 100%; Pig: 92%
Image 1
Human HepG2
WB Suggested Anti-JMJD2B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com