MUC3B Antibody - middle region (ARP58396_P050)

Data Sheet
 
Product Number ARP58396_P050
Product Page www.avivasysbio.com/muc3b-antibody-middle-region-arp58396-p050.html
Name MUC3B Antibody - middle region (ARP58396_P050)
Protein Size (# AA) 1009 amino acids
Molecular Weight 107kDa
NCBI Gene Id 57876
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Mucin 3B, cell surface associated
Alias Symbols MUC3, MUC3A
Peptide Sequence Synthetic peptide located within the following region: KTTLKEGLQNASQDANSCQDSQTLCFKPDSIKVNNNSKTELTPEAICRRA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MUC3B (ARP58396_P050) antibody
Blocking Peptide For anti-MUC3B (ARP58396_P050) antibody is Catalog # AAP58396 (Previous Catalog # AAPP33405)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MUC3B
Uniprot ID Q9H195
Protein Accession # XP_001125753
Purification Affinity Purified
Nucleotide Accession # XM_001125753
Tested Species Reactivity Human
Gene Symbol MUC3B
Predicted Species Reactivity Human, Cow
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Human: 100%
Image 1
Human MCF-7
WB Suggested Anti-MUC3B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com