| Product Number |
ARP58395_P050 |
| Product Page |
www.avivasysbio.com/muc3b-antibody-n-terminal-region-arp58395-p050.html |
| Name |
MUC3B Antibody - N-terminal region (ARP58395_P050) |
| Protein Size (# AA) |
310 amino acids |
| Molecular Weight |
34kDa |
| NCBI Gene Id |
57876 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Mucin 3B, cell surface associated |
| Alias Symbols |
MUC3, MUC3A |
| Peptide Sequence |
Synthetic peptide located within the following region: KSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
0 |
| Description of Target |
MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MUC3B (ARP58395_P050) antibody |
| Blocking Peptide |
For anti-MUC3B (ARP58395_P050) antibody is Catalog # AAP58395 (Previous Catalog # AAPP33404) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MUC3B |
| Uniprot ID |
Q9H195 |
| Publications |
Song, J. S. et al. Comparative gene expression analysis of the human periodontal ligament in deciduous and permanent teeth. PLoS One 8, e61231 (2013). 23593441 |
| Protein Accession # |
XP_001718007 |
| Purification |
Affinity Purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MUC3B |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human MCF-7
 | WB Suggested Anti-MUC3B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate |
|
|
