MLX Antibody - N-terminal region (ARP58362_P050)

Data Sheet
 
Product Number ARP58362_P050
Product Page www.avivasysbio.com/mlx-antibody-n-terminal-region-arp58362-p050.html
Name MLX Antibody - N-terminal region (ARP58362_P050)
Protein Size (# AA) 244 amino acids
Molecular Weight 28kDa
NCBI Gene Id 6945
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name MAX-like protein X
Alias Symbols TF4, MAD7, MXD7, TCFL4, bHLHd13
Peptide Sequence Synthetic peptide located within the following region: GSCENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Stoltzman,C.A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (19), 6912-6917
Description of Target MLX belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. MLX may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
Protein Interactions ZBTB32; GABARAPL2; RBM39; AES; UBC; SAP30BP; ID3; APP; SUMO1; MLXIPL; MLXIP; MXD4; MNT; MAD1L1; MLX; MXD1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for ARP58362_P050
Blocking Peptide Catalog # AAP58362 (Previous Catalog # AAPP32972)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MLX
Uniprot ID Q9UH92-3
Protein Name Max-like protein X
Sample Type Confirmation

MLX is strongly supported by BioGPS gene expression data to be expressed in MCF7

Protein Accession # NP_937847
Purification Affinity Purified
Nucleotide Accession # NM_198204
Tested Species Reactivity Human, Mouse
Gene Symbol MLX
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Mouse Skeletal Muscle
Host: Mouse
Target Name: MLX
Sample Tissue: Mouse Skeletal Muscle
Antibody Dilution: 1ug/ml
Image 2
Human MCF7
WB Suggested Anti-MLX Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysateMLX is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com