TLK1 Antibody - N-terminal region (ARP58340_P050)

Data Sheet
 
Product Number ARP58340_P050
Product Page www.avivasysbio.com/tlk1-antibody-n-terminal-region-arp58340-p050.html
Name TLK1 Antibody - N-terminal region (ARP58340_P050)
Protein Size (# AA) 766 amino acids
Molecular Weight 84kDa
NCBI Gene Id 9874
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Tousled-like kinase 1
Alias Symbols PKU-beta
Peptide Sequence Synthetic peptide located within the following region: ESETPEKKQSESSRGRKRKAENQNESSQGKSIGGRGHKISDYFEYQGGNG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Description of Target The Tousled-like kinases, first described in Arabadopsis, are nuclear serine/threonine kinases that are potentially involved in the regulation of chromatin assembly.The Tousled-like kinases, first described in Arabadopsis, are nuclear serine/threonine kinases that are potentially involved in the regulation of chromatin assembly.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions LUZP4; TLK1; TPM3; UBC; ASF1A; UBE3C; INPP1; XPO7; NBN; MBP; CHEK1; ELAVL1; Dynll1; AURKA; YWHAE; ASF1B; TLK2; SNAP23; HIST1H1A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TLK1 (ARP58340_P050) antibody
Blocking Peptide For anti-TLK1 (ARP58340_P050) antibody is Catalog # AAP58340 (Previous Catalog # AAPP32950)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TLK1
Uniprot ID Q9UKI8
Protein Name Serine/threonine-protein kinase tousled-like 1
Sample Type Confirmation

TLK1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_036422
Purification Affinity Purified
Nucleotide Accession # NM_012290
Tested Species Reactivity Human
Gene Symbol TLK1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Image 1
Human 721_B
WB Suggested Anti-TLK1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysateTLK1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com