| Product Number |
ARP58334_P050 |
| Product Page |
www.avivasysbio.com/sycp3-antibody-n-terminal-region-arp58334-p050.html |
| Name |
SYCP3 Antibody - N-terminal region (ARP58334_P050) |
| Protein Size (# AA) |
236 amino acids |
| Molecular Weight |
26kDa |
| NCBI Gene Id |
50511 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Synaptonemal complex protein 3 |
| Alias Symbols |
COR1, SCP3, SPGF4, RPRGL4 |
| Peptide Sequence |
Synthetic peptide located within the following region: VSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Bukovsky,A., (2008) Cell Cycle 7 (5), 683-686 |
| Description of Target |
SYCP3 is a component of the transverse filaments of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. It has an essential meiotic function in spermatogenesis. SYCP3 may be important for testis development. |
| Protein Interactions |
LIG4; PABPC1; REC8; SMC3; SMC1A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SYCP3 (ARP58334_P050) antibody |
| Blocking Peptide |
For anti-SYCP3 (ARP58334_P050) antibody is Catalog # AAP58334 (Previous Catalog # AAPP32944) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SYCP3 |
| Uniprot ID |
Q8IZU3 |
| Protein Name |
Synaptonemal complex protein 3 |
| Protein Accession # |
NP_710161 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_153694 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SYCP3 |
| Predicted Species Reactivity |
Human |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-SYCP3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
| | Image 2 | Human Testis
 | Immunohistochemistry with Testis tissue at an antibody concentration of 5ug/ml using anti-SYCP3 antibody (ARP58334_P050) |
|
|
