PDS5B Antibody - middle region (ARP58313_P050)

Data Sheet
 
Product Number ARP58313_P050
Product Page www.avivasysbio.com/pds5b-antibody-middle-region-arp58313-p050.html
Name PDS5B Antibody - middle region (ARP58313_P050)
Protein Size (# AA) 1447 amino acids
Molecular Weight 159kDa
NCBI Gene Id 23047
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae)
Alias Symbols AS3, APRIN, CG008
Peptide Sequence Synthetic peptide located within the following region: DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Gregory,S.G., (2006) Nature 441 (7091), 315-321
Description of Target PDS5B plays a role in androgen-induced proliferative arrest in prostate cells. It is required for maintenance of sister chromatid cohesion during mitosis. Defects in PDS5B may be the cause of some cancers including esophageal cancer.
Protein Interactions UBC; EED; RNF2; CDCA5; LAMP2; APP; NSMCE2; SIRT7; RAD21; STAG2; STAG1; SMC3; SMC1A; SUMO1; WAPAL; WFDC5; PDS5A; tat;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PDS5B (ARP58313_P050) antibody
Blocking Peptide For anti-PDS5B (ARP58313_P050) antibody is Catalog # AAP58313 (Previous Catalog # AAPP32923)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PDS5B
Uniprot ID Q9NTI5
Protein Name Sister chromatid cohesion protein PDS5 homolog B
Sample Type Confirmation

PDS5B is strongly supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_055847
Purification Affinity Purified
Nucleotide Accession # NM_015032
Tested Species Reactivity Human
Gene Symbol PDS5B
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Image 1
Human 721_B
WB Suggested Anti-PDS5B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysatePDS5B is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com