JMJD8 Antibody - middle region (ARP58212_P050)

Data Sheet
 
Product Number ARP58212_P050
Product Page www.avivasysbio.com/jmjd8-antibody-middle-region-arp58212-p050.html
Name JMJD8 Antibody - middle region (ARP58212_P050)
Protein Size (# AA) 285 amino acids
Molecular Weight 32kDa
NCBI Gene Id 339123
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Jumonji domain containing 8
Alias Symbols PP14397, C16orf20
Peptide Sequence Synthetic peptide located within the following region: SFGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Daniels,R.J., (2001) Hum. Mol. Genet. 10 (4), 339-352
Description of Target The functions of LOC339123 remain unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-JMJD8 (ARP58212_P050) antibody
Blocking Peptide For anti-JMJD8 (ARP58212_P050) antibody is Catalog # AAP58212 (Previous Catalog # AAPP32811)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human LOC339123
Uniprot ID Q96S16
Protein Name JmjC domain-containing protein 8
Protein Accession # NP_001005920
Purification Affinity Purified
Nucleotide Accession # NM_001005920
Tested Species Reactivity Human
Gene Symbol JMJD8
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 85%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rat: 93%
Image 1
Human MCF-7
WB Suggested Anti-JMJD8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com