| Product Number |
ARP58212_P050 |
| Product Page |
www.avivasysbio.com/jmjd8-antibody-middle-region-arp58212-p050.html |
| Name |
JMJD8 Antibody - middle region (ARP58212_P050) |
| Protein Size (# AA) |
285 amino acids |
| Molecular Weight |
32kDa |
| NCBI Gene Id |
339123 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Jumonji domain containing 8 |
| Alias Symbols |
PP14397, C16orf20 |
| Peptide Sequence |
Synthetic peptide located within the following region: SFGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Daniels,R.J., (2001) Hum. Mol. Genet. 10 (4), 339-352 |
| Description of Target |
The functions of LOC339123 remain unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-JMJD8 (ARP58212_P050) antibody |
| Blocking Peptide |
For anti-JMJD8 (ARP58212_P050) antibody is Catalog # AAP58212 (Previous Catalog # AAPP32811) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LOC339123 |
| Uniprot ID |
Q96S16 |
| Protein Name |
JmjC domain-containing protein 8 |
| Protein Accession # |
NP_001005920 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001005920 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
JMJD8 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rat: 93% |
| Image 1 | Human MCF-7
 | WB Suggested Anti-JMJD8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate |
|
|
