A2BP1 Antibody - N-terminal region (ARP58202_P050)

Data Sheet
 
Product Number ARP58202_P050
Product Page www.avivasysbio.com/a2bp1-antibody-n-terminal-region-arp58202-p050.html
Name A2BP1 Antibody - N-terminal region (ARP58202_P050)
Protein Size (# AA) 370 amino acids
Molecular Weight 40kDa
NCBI Gene Id 54715
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name RNA binding protein, fox-1 homolog (C. elegans) 1
Alias Symbols 2BP1, FOX1, A2BP1, FOX-1, HRNBP1
Peptide Sequence Synthetic peptide located within the following region: NCEREQLRGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Ataxin-2 binding protein 1(A2BP1) has an RNP motif that is highly conserved among RNA-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the gene product of the SCA2 gene which causes familial neurodegenerative diseases. Ataxin-2 binding protein 1 and ataxin-2 are both localized in the trans-Golgi network. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been found but their full length nature has not been determined.
Protein Interactions C1orf94; RBPMS; PRR20A; HSFY1; RHOXF2; ALG13; RBFOX1; FAM168A; DAZAP2; MAGED1; BHLHE40; SNRPN; DAB1; CRX; UBC; HSFX1; RBM24; LZTS2; DMRTB1; PCBP4; NOC2L; GCA; RBFOX2; KIFAP3; CELF3; PSMF1; QKI; NUMBL; PRRC2A; ATXN2; ATXN1; HNRNPF; DVL2; ATN1; TNIP1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RBFOX1 (ARP58202_P050) antibody
Blocking Peptide For anti-RBFOX1 (ARP58202_P050) antibody is Catalog # AAP58202
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human A2BP1
Uniprot ID Q9NWB1
Protein Name RNA binding protein fox-1 homolog 1
Protein Accession # NP_001135805
Purification Affinity Purified
Nucleotide Accession # NM_001142333
Tested Species Reactivity Human
Gene Symbol RBFOX1
Predicted Species Reactivity Human, Mouse, Cow
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Human: 100%; Mouse: 100%
Image 1
Human Brain, Human Placenta
Host: Rabbit
Target: RBFOX1
Positive control (+): Human Brain (BR)
Negative control (-): Human Placenta (PL)
Antibody concentration: 1ug/ml
Image 2
Human 293T
Host: Rabbit
Target Name: HIRIP3
Sample Type: 293T
Antibody Dilution: 1.0ug/ml
Image 3
Human A549 Whole Cell
Host: Rabbit
Target Name: A2BP1
Sample Type: A549 Whole Cell lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com