ZNF442 Antibody - middle region (ARP58189_P050)

• Product Number: ARP58189_P050
• Name: ZNF442 Antibody - middle region (ARP58189_P050)
• Protein Size (# AA): 627 amino acids
• Molecular Weight: 73kDa
• NCBI Gene Id: 79973
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Zinc finger protein 442
• Alias Symbols: FLJ14356
• Peptide Sequence: Synthetic peptide located within the following region: YLRHERTHTGEKPYECKHCSKAFPDYSSYVRHERTHTGEKPYKCKRCGRA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65
• Description of Target: ZNF442 Belongs to the krueppel C2H2-type zinc-finger protein family. It contains 16 C2H2-type zinc fingers and 1 KRAB domain. ZNF442 may be involved in transcriptional regulation.
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZNF442 (ARP58189_P050) antibody is Catalog # AAP58189 (Previous Catalog # AAPP32641)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF442
• Uniprot ID: Q9H7R0
• Protein Name: Zinc finger protein 442
• Protein Accession #: NP_110451
• Purification: Affinity Purified
• Nucleotide Accession #: NM_030824
• Tested Species Reactivity: Human
• Gene Symbol: ZNF442
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 92%; Guinea Pig: 85%; Horse: 92%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 92%
• Image 1: Human Liver
  
  WB Suggested Anti-ZNF442 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human Liver