RNF5 Antibody - N-terminal region (ARP58178_P050)

Data Sheet
 
Product Number ARP58178_P050
Product Page www.avivasysbio.com/rnf5-antibody-n-terminal-region-arp58178-p050.html
Name RNF5 Antibody - N-terminal region (ARP58178_P050)
Protein Size (# AA) 180 amino acids
Molecular Weight 20kDa
NCBI Gene Id 6048
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ring finger protein 5, E3 ubiquitin protein ligase
Alias Symbols RMA1, RING5
Peptide Sequence Synthetic peptide located within the following region: AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Bromberg,K.D., (2007) Cancer Res. 67 (17), 8172-8179
Description of Target RNF5 contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and altering the distribution and localization of paxillin in cytoplasm and cell focal adhesions.The protein encoded by this gene contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and altering the distribution and localization of paxillin in cytoplasm and cell focal adhesions. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions TMEM242; CYB561A3; RNF185; YIPF2; UBE2W; SLC38A7; UBE2D4; INSIG2; SEC22A; UBE2E3; ABHD16A; UBE2E2; UBE2D3; UBE2D1; UBC; SLC1A1; RNF5; UBE2K; CYB561; PTGDR2; ADRB2; PXN; env; TNFAIP3; UBC5; DERL1; UBE2J1; UBE2N; UBE2G2; UBE2D2; CFTR; BCAP31; TMEM173; MAVS;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RNF5 (ARP58178_P050) antibody
Blocking Peptide For anti-RNF5 (ARP58178_P050) antibody is Catalog # AAP58178 (Previous Catalog # AAPP32630)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RNF5
Uniprot ID Q99942
Protein Name E3 ubiquitin-protein ligase RNF5
Sample Type Confirmation

RNF5 is supported by BioGPS gene expression data to be expressed in HeLa

Protein Accession # NP_008844
Purification Affinity Purified
Nucleotide Accession # NM_006913
Tested Species Reactivity Human
Gene Symbol RNF5
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Image 1
HepG2 Cell Lysate
Host: Rabbit
Target: RNF5
Positive control (+): HepG2 Cell Lysate (HG)
Negative control (-): Human Stomach Tumor (T-ST)
Antibody concentration: 1ug/ml
Image 2
Human HeLa
WB Suggested Anti-RNF5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Hela cell lysateRNF5 is supported by BioGPS gene expression data to be expressed in HeLa
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com