| Product Number |
ARP58173_P050 |
| Product Page |
www.avivasysbio.com/scand2-antibody-middle-region-arp58173-p050.html |
| Name |
SCAND2 Antibody - middle region (ARP58173_P050) |
| Protein Size (# AA) |
152 amino acids |
| Molecular Weight |
18kDa |
| NCBI Gene Id |
54581 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
SCAN domain containing 2 pseudogene |
| Alias Symbols |
SCAND2 |
| Peptide Sequence |
Synthetic peptide located within the following region: IQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
0 |
| Description of Target |
The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. Functional studies have established that the SCAN box is a protein interaction domain that mediates both hetero- and homoprotein associations, and maybe involved in regulation of transcriptional activity. |
| Protein Interactions |
APP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SCAND2P (ARP58173_P050) antibody |
| Blocking Peptide |
For anti-SCAND2P (ARP58173_P050) antibody is Catalog # AAP58173 (Previous Catalog # AAPP32625) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SCAND2 |
| Uniprot ID |
A8K374 |
| Protein Name |
Putative SCAN domain-containing protein 2 |
| Protein Accession # |
NP_378666 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_033640 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SCAND2P |
| Predicted Species Reactivity |
Human, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Horse: 100%; Human: 100% |
| Image 1 | Human HeLa
 | WB Suggested Anti-SCAND2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate |
|
|
