NRL Antibody - C-terminal region (ARP58167_P050)

Data Sheet
 
Product Number ARP58167_P050
Product Page www.avivasysbio.com/nrl-antibody-c-terminal-region-arp58167-p050.html
Name NRL Antibody - C-terminal region (ARP58167_P050)
Protein Size (# AA) 237 amino acids
Molecular Weight 26kDa
NCBI Gene Id 4901
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name neural retina leucine zipper
Alias Symbols RP27, D14S46E, NRL-MAF
Peptide Sequence Synthetic peptide located within the following region: LEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a basic motif-leucine zipper transcription factor of the Maf subfamily. The encoded protein is conserved among vertebrates and is a critical intrinsic regulator of photoceptor development and function. Mutations in this gene have been associated with retinitis pigmentosa and retinal degenerative diseases.
Protein Interactions EDF1; FIZ1; CRX;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NRL (ARP58167_P050) antibody
Blocking Peptide For anti-NRL (ARP58167_P050) antibody is Catalog # AAP58167
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human NRL
Uniprot ID P54845
Protein Name Neural retina-specific leucine zipper protein
Protein Accession # XP_005267767
Purification Affinity Purified
Tested Species Reactivity Human
Gene Symbol NRL
Predicted Species Reactivity Human, Rat, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Esophagus Tumor
Host: Rabbit
Target Name: NRL
Sample Type: Esophagus Tumor lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com