Product Number |
ARP58167_P050 |
Product Page |
www.avivasysbio.com/nrl-antibody-c-terminal-region-arp58167-p050.html |
Name |
NRL Antibody - C-terminal region (ARP58167_P050) |
Protein Size (# AA) |
237 amino acids |
Molecular Weight |
26kDa |
NCBI Gene Id |
4901 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
neural retina leucine zipper |
Alias Symbols |
RP27, D14S46E, NRL-MAF |
Peptide Sequence |
Synthetic peptide located within the following region: LEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a basic motif-leucine zipper transcription factor of the Maf subfamily. The encoded protein is conserved among vertebrates and is a critical intrinsic regulator of photoceptor development and function. Mutations in this gene have been associated with retinitis pigmentosa and retinal degenerative diseases. |
Protein Interactions |
EDF1; FIZ1; CRX; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NRL (ARP58167_P050) antibody |
Blocking Peptide |
For anti-NRL (ARP58167_P050) antibody is Catalog # AAP58167 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human NRL |
Uniprot ID |
P54845 |
Protein Name |
Neural retina-specific leucine zipper protein |
Protein Accession # |
XP_005267767 |
Purification |
Affinity Purified |
Tested Species Reactivity |
Human |
Gene Symbol |
NRL |
Predicted Species Reactivity |
Human, Rat, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Esophagus Tumor
| Host: Rabbit Target Name: NRL Sample Type: Esophagus Tumor lysates Antibody Dilution: 1.0ug/ml |
|
|