MAFB Antibody - C-terminal region (ARP58149_P050)

• Product Number: ARP58149_P050
• Name: MAFB Antibody - C-terminal region (ARP58149_P050)
• Protein Size (# AA): 323 amino acids
• Molecular Weight: 36 kDa
• NCBI Gene Id: 9935
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: V-maf musculoaponeurotic fibrosarcoma oncogene homolog B (avian)
• Alias Symbols: KRML, MCTO, DURS3
• Peptide Sequence: Synthetic peptide located within the following region: LIQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Gemelli,C., (2006) Cell Death Differ. 13 (10), 1686-1696
• Description of Target: MAFB is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells. The protein encoded by this gene is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The encoded nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells. This gene contains no introns. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: MAFB; FOSL1; MAF; FOS; BACH1; ATF4; IKBKE; IRF7; IRF3; ZWINT; ZFP64; ZDHHC2; DDB1; JUN; HOXD12;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-MAFB (ARP58149_P050) antibody is Catalog # AAP58149 (Previous Catalog # AAPP32582)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MAFB
• Uniprot ID: Q9Y5Q3
• Protein Name: Transcription factor MafB
• Protein Accession #: NP_005452
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005461
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: MAFB
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
• Image 1: Human Fetal Lung
  
  Host: Rabbit
  Target Name: MAFB
  Sample Type: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml
• Image 2: Human Fetal Heart
  
  Host: Rabbit
  Target Name: MAFB
  Sample Type: Human Fetal Heart
  Antibody Dilution: 1.0ug/ml
• Image 3: Mouse Brain
  
  Host: Mouse
  Target Name: MAFB
  Sample Tissue: Mouse Brain
  Antibody Dilution: 1ug/ml
• Image 4: Human Muscle
  
  WB Suggested Anti-MAFB Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human Muscle