MED14 Antibody - middle region (ARP58139_P050)

• Product Number: ARP58139_P050
• Name: MED14 Antibody - middle region (ARP58139_P050)
• Protein Size (# AA): 1454 amino acids
• Molecular Weight: 161 kDa
• Subunit: 14
• NCBI Gene Id: 9282
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Mediator complex subunit 14
• Alias Symbols: CSRP, RGR1, CRSP2, EXLM1, CXorf4, CRSP150, DRIP150, TRAP170
• Peptide Sequence: Synthetic peptide located within the following region: AADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation.
• Protein Interactions: UBC; HECW2; CDK8; CDK19; MED12; ESR1; MED19; MED26; PPARG; FBXW7; EPAS1; MED11; MED8; MED29; MED18; MED4; PPP6R1; MED16; MED13; MED24; MED27; MED17; MED21; MED1; CTDP1; SREBF1; DCTN1; ACTN2; ACTN1; MED10; UACA; NECAB2; MED25; MED15; CRSP5; MED7; MED23; VD
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-MED14 (ARP58139_P050) antibody is Catalog # AAP58139 (Previous Catalog # AAPP43619)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MED14
• Uniprot ID: O60244
• Protein Name: Mediator of RNA polymerase II transcription subunit 14
• Sample Type Confirmation:

  MED14 is strongly supported by BioGPS gene expression data to be expressed in A549

• Protein Accession #: NP_004220
• Purification: Affinity Purified
• Nucleotide Accession #: NM_004229
• Tested Species Reactivity: Human
• Gene Symbol: MED14
• Predicted Species Reactivity: Human, Mouse, Rabbit
• Application: WB, CHIP
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Mouse: 79%; Rabbit: 86%
• Image 1: Human A549
  
  WB Suggested Anti-MED14 Antibody Titration: 0.2-1 ug/ml
  Positive Control: A549 cell lysateMED14 is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells
• Image 2: HCT116
  
  Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.