TRIM15 Antibody - middle region (ARP58130_P050)

• Product Number: ARP58130_P050
• Name: TRIM15 Antibody - middle region (ARP58130_P050)
• Protein Size (# AA): 465 amino acids
• Molecular Weight: 52kDa
• NCBI Gene Id: 89870
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Tripartite motif containing 15
• Alias Symbols: RNF93, ZNFB7, ZNF178
• Peptide Sequence: Synthetic peptide located within the following region: HLEIDSGVITLDPQTASRSLVLSEDRKSVRYTRQKKSLPDSPLRFDGLPA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Uchil,P.D., PLoS Pathog. 4 (2), E16 (2008)
• Description of Target: TRIM15 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. Its function has not been identified. The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
• Protein Interactions: FAM151B; FAM161A; RABGEF1; TRIM8; TINF2; ACD; TRIM15; EHMT1; TAF9B; SNW1; MED7; MYBL2; IRF5; GTF2E1; UBE2U;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TRIM15 (ARP58130_P050) antibody is Catalog # AAP58130 (Previous Catalog # AAPP32563)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM15
• Uniprot ID: Q9C019
• Protein Name: Tripartite motif-containing protein 15
• Sample Type Confirmation:

  TRIM15 is strongly supported by BioGPS gene expression data to be expressed in 721_B

• Protein Accession #: NP_150232
• Purification: Affinity Purified
• Nucleotide Accession #: NM_033229
• Tested Species Reactivity: Human
• Gene Symbol: TRIM15
• Predicted Species Reactivity: Human, Cow, Pig, Rabbit, Yeast
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Human: 100%; Pig: 86%; Rabbit: 79%; Yeast: 100%
• Image 1: Human 721_B
  
  WB Suggested Anti-TRIM15 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: 721_B cell lysateTRIM15 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
• Image 2: Human Adult Placenta
  
  Host: Rabbit
  Target Name: TRIM15
  Sample Type: Human Adult Placenta
  Antibody Dilution: 1.0ug/ml
• Image 3: Human Fetal Muscle
  
  Host: Rabbit
  Target Name: TRIM15
  Sample Type: Human Fetal Muscle
  Antibody Dilution: 1.0ug/ml
• Image 4: Human heart
  
  WB Suggested Anti-TRIM15 antibody Titration: 1 ug/mL
  Sample Type: Human heart
• Image 5: heart
  
  Rabbit Anti-TRIM15 Antibody
  Catalog Number: ARP58130_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Adult heart
  Observed Staining: Cytoplasmic
  Primary Antibody Concentration: 1:600
  Secondary Antibody: Donkey anti-Rabbit-Cy2/3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 – 2.0 sec
  Protocol located in Reviews and Data.