JMJD5 Antibody - middle region : HRP (ARP58120_P050-HRP)

Data Sheet
 
Product Number ARP58120_P050-HRP
Product Page www.avivasysbio.com/jmjd5-antibody-middle-region-hrp-arp58120-p050-hrp.html
Name JMJD5 Antibody - middle region : HRP (ARP58120_P050-HRP)
Protein Size (# AA) 416 amino acids
Molecular Weight 47kDa
Conjugation HRP: Horseradish Peroxidase
NCBI Gene Id 79831
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Lysine (K)-specific demethylase 8
Alias Symbols JMJD5
Peptide Sequence Synthetic peptide located within the following region: LKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMG
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reference Imataka,H., (2007) Nat. Rev. Genet. 8 (11), 829-833
Description of Target JMJD5 is a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor.JMJD5 is a putative histone lysine demethylase that contains a Jumonji C (JmjC) domain (Shi, 2007 [PubMed 17909537]).[supplied by OMIM].
Protein Interactions PCYT2;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-KDM8 (ARP58120_P050-HRP) antibody
Blocking Peptide For anti-KDM8 (ARP58120_P050-HRP) antibody is Catalog # AAP58120 (Previous Catalog # AAPP32553)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human JMJD5
Uniprot ID Q8N371
Protein Name Lysine-specific demethylase 8
Protein Accession # NP_079049
Purification Affinity Purified
Nucleotide Accession # NM_024773
Gene Symbol KDM8
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application CHIP, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com