Product Number |
ARP58120_P050 |
Product Page |
www.avivasysbio.com/jmjd5-antibody-middle-region-arp58120-p050.html |
Name |
JMJD5 Antibody - middle region (ARP58120_P050) |
Protein Size (# AA) |
416 amino acids |
Molecular Weight |
47kDa |
NCBI Gene Id |
79831 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Lysine (K)-specific demethylase 8 |
Alias Symbols |
JMJD5 |
Peptide Sequence |
Synthetic peptide located within the following region: LKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Imataka,H., (2007) Nat. Rev. Genet. 8 (11), 829-833 |
Description of Target |
JMJD5 is a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor.JMJD5 is a putative histone lysine demethylase that contains a Jumonji C (JmjC) domain (Shi, 2007 [PubMed 17909537]).[supplied by OMIM]. |
Protein Interactions |
PCYT2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-KDM8 (ARP58120_P050) antibody |
Blocking Peptide |
For anti-KDM8 (ARP58120_P050) antibody is Catalog # AAP58120 (Previous Catalog # AAPP32553) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human JMJD5 |
Uniprot ID |
Q8N371 |
Protein Name |
Lysine-specific demethylase 8 |
Protein Accession # |
NP_079049 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_024773 |
Tested Species Reactivity |
Human |
Gene Symbol |
KDM8 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
CHIP, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
Image 1 | Human Liver
| WB Suggested Anti-JMJD5 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Liver |
|
Image 2 | Human Fetal Liver
| Host: Rabbit Target Name: JMJD5 Sample Type: Human Fetal Liver Antibody Dilution: 1.0ug/ml |
|
Image 3 | HCT116
| Chromatin Immunoprecipitation (ChIP) Using JMJD5 antibody - middle region (ARP58120_P050) and HCT116 Cells |
|