| Product Number |
ARP58103_P050 |
| Product Page |
www.avivasysbio.com/znf134-antibody-middle-region-arp58103-p050.html |
| Name |
ZNF134 Antibody - middle region (ARP58103_P050) |
| Protein Size (# AA) |
427 amino acids |
| Molecular Weight |
48kDa |
| NCBI Gene Id |
7693 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 134 |
| Alias Symbols |
pHZ-15 |
| Peptide Sequence |
Synthetic peptide located within the following region: TLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYKCSECGKAFSRKDTLVQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Tommerup,N. (1995) Genomics 27 (2), 259-264 |
| Description of Target |
ZNF134 is a candidate transcription factor. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF134 (ARP58103_P050) antibody |
| Blocking Peptide |
For anti-ZNF134 (ARP58103_P050) antibody is Catalog # AAP58103 (Previous Catalog # AAPP32536) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF134 |
| Uniprot ID |
P52741 |
| Protein Name |
Zinc finger protein 134 |
| Sample Type Confirmation |
ZNF134 is supported by BioGPS gene expression data to be expressed in HEK293T |
| Protein Accession # |
NP_003426 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003435 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF134 |
| Predicted Species Reactivity |
Human, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Pig: 85% |
| Image 1 | Human 293T
 | WB Suggested Anti-ZNF134 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysateZNF134 is supported by BioGPS gene expression data to be expressed in HEK293T |
|
|
