ZNF134 Antibody - middle region (ARP58103_P050)

Data Sheet
 
Product Number ARP58103_P050
Product Page www.avivasysbio.com/znf134-antibody-middle-region-arp58103-p050.html
Name ZNF134 Antibody - middle region (ARP58103_P050)
Protein Size (# AA) 427 amino acids
Molecular Weight 48kDa
NCBI Gene Id 7693
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 134
Alias Symbols pHZ-15
Peptide Sequence Synthetic peptide located within the following region: TLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYKCSECGKAFSRKDTLVQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Tommerup,N. (1995) Genomics 27 (2), 259-264
Description of Target ZNF134 is a candidate transcription factor.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF134 (ARP58103_P050) antibody
Blocking Peptide For anti-ZNF134 (ARP58103_P050) antibody is Catalog # AAP58103 (Previous Catalog # AAPP32536)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ZNF134
Uniprot ID P52741
Protein Name Zinc finger protein 134
Sample Type Confirmation

ZNF134 is supported by BioGPS gene expression data to be expressed in HEK293T

Protein Accession # NP_003426
Purification Affinity Purified
Nucleotide Accession # NM_003435
Tested Species Reactivity Human
Gene Symbol ZNF134
Predicted Species Reactivity Human, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Pig: 85%
Image 1
Human 293T
WB Suggested Anti-ZNF134 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysateZNF134 is supported by BioGPS gene expression data to be expressed in HEK293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com