Product Number |
ARP58103_P050 |
Product Page |
www.avivasysbio.com/znf134-antibody-middle-region-arp58103-p050.html |
Name |
ZNF134 Antibody - middle region (ARP58103_P050) |
Protein Size (# AA) |
427 amino acids |
Molecular Weight |
48kDa |
NCBI Gene Id |
7693 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 134 |
Alias Symbols |
pHZ-15 |
Peptide Sequence |
Synthetic peptide located within the following region: TLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYKCSECGKAFSRKDTLVQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Tommerup,N. (1995) Genomics 27 (2), 259-264 |
Description of Target |
ZNF134 is a candidate transcription factor. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF134 (ARP58103_P050) antibody |
Blocking Peptide |
For anti-ZNF134 (ARP58103_P050) antibody is Catalog # AAP58103 (Previous Catalog # AAPP32536) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF134 |
Uniprot ID |
P52741 |
Protein Name |
Zinc finger protein 134 |
Sample Type Confirmation |
ZNF134 is supported by BioGPS gene expression data to be expressed in HEK293T |
Protein Accession # |
NP_003426 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_003435 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF134 |
Predicted Species Reactivity |
Human, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100%; Pig: 85% |
Image 1 | Human 293T
| WB Suggested Anti-ZNF134 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: 293T cell lysateZNF134 is supported by BioGPS gene expression data to be expressed in HEK293T |
|
|