| Product Number |
ARP58101_P050 |
| Product Page |
www.avivasysbio.com/zfpl1-antibody-middle-region-arp58101-p050.html |
| Name |
ZFPL1 Antibody - middle region (ARP58101_P050) |
| Protein Size (# AA) |
310 amino acids |
| Molecular Weight |
34kDa |
| NCBI Gene Id |
7542 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein-like 1 |
| Alias Symbols |
MCG4, D11S750 |
| Peptide Sequence |
Synthetic peptide located within the following region: LLQRAGLLLLLGLLGFLALLALMSRLGRAAADSDPNLDPLMNPHIRVGPS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Chiu,C.F., (2008) EMBO J. 27 (7), 934-947 |
| Description of Target |
ZFPL1 is expressed strongly in the exocrine pancreas as a 1.4-kb polyadenylated RNA encoding a putative protein of 310 amino acids. |
| Protein Interactions |
UBC; ATP5J2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZFPL1 (ARP58101_P050) antibody |
| Blocking Peptide |
For anti-ZFPL1 (ARP58101_P050) antibody is Catalog # AAP58101 (Previous Catalog # AAPP32534) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZFPL1 |
| Uniprot ID |
O95159 |
| Protein Name |
Zinc finger protein-like 1 |
| Protein Accession # |
NP_006773 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006782 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZFPL1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77% |
| Image 1 | Human Liver
 | WB Suggested Anti-ZFPL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver |
|
|
