| Product Number |
ARP58058_P050 |
| Product Page |
www.avivasysbio.com/trim49-antibody-middle-region-arp58058-p050.html |
| Name |
TRIM49 Antibody - middle region (ARP58058_P050) |
| Protein Size (# AA) |
452 amino acids |
| Molecular Weight |
53kDa |
| NCBI Gene Id |
57093 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Tripartite motif containing 49 |
| Alias Symbols |
RNF18, TRIM49A, TRIM49L2 |
| Peptide Sequence |
Synthetic peptide located within the following region: NMYRKEKNQNEKIDGKAGLFLLGCVKNDIQCSLFTTSPLMLQYIPKPTSR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
TRIM49 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein has been found to be preferentially expressed in testis. |
| Protein Interactions |
BLM; HSP90AA1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TRIM49 (ARP58058_P050) antibody |
| Blocking Peptide |
For anti-TRIM49 (ARP58058_P050) antibody is Catalog # AAP58058 (Previous Catalog # AAPP32481) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TRIM49 |
| Uniprot ID |
Q9NS80 |
| Protein Accession # |
NP_065091 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_020358 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TRIM49 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human HT1080
 | WB Suggested Anti-TRIM49 Antibody Titration: 0.2-1 ug/ml
Positive Control: HT1080 cell lysate |
|
|
