ZNF334 Antibody - N-terminal region (ARP58055_P050)

• Product Number: ARP58055_P050
• Name: ZNF334 Antibody - N-terminal region (ARP58055_P050)
• Protein Size (# AA): 680 amino acids
• Molecular Weight: 80kDa
• NCBI Gene Id: 55713
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Zinc finger protein 334
• Alias Symbols: -
• Peptide Sequence: Synthetic peptide located within the following region: KMKKFQIPVSFQDLTVNFTQEEWQQLDPAQRLLYRDVMLENYSNLVSVGY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Deloukas,P., (2001) Nature 414 (6866), 865-871
• Description of Target: ZNF334 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 14 C2H2-type zinc fingers and 1 KRAB domain. ZNF334 may be involved in transcriptional regulation.
• Protein Interactions: CCNDBP1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZNF334 (ARP58055_P050) antibody is Catalog # AAP58055 (Previous Catalog # AAPP32478)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF334
• Uniprot ID: Q9HCZ1
• Protein Name: Zinc finger protein 334
• Protein Accession #: NP_060572
• Purification: Affinity Purified
• Nucleotide Accession #: NM_018102
• Tested Species Reactivity: Human
• Gene Symbol: ZNF334
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 79%; Horse: 79%; Human: 100%; Mouse: 79%; Pig: 79%; Rabbit: 86%; Rat: 79%
• Image 1: Human HeLa
  
  WB Suggested Anti-ZNF334 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Hela cell lysate