HOXD12 Antibody - middle region (ARP58025_P050)

Data Sheet
 
Product Number ARP58025_P050
Product Page www.avivasysbio.com/hoxd12-antibody-middle-region-arp58025-p050.html
Name HOXD12 Antibody - middle region (ARP58025_P050)
Protein Size (# AA) 279 amino acids
Molecular Weight 30kDa
NCBI Gene Id 3238
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Homeobox D12
Alias Symbols HOX4H
Peptide Sequence Synthetic peptide located within the following region: AELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKRVVLRE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference 0
Description of Target HOXD12 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters,
Protein Interactions TRAF1; CREBBP; MAFF; MAFG; MEIS1; MAFB; MAFK; MAF;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HOXD12 (ARP58025_P050) antibody
Blocking Peptide For anti-HOXD12 (ARP58025_P050) antibody is Catalog # AAP58025 (Previous Catalog # AAPP32448)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HOXD12
Uniprot ID P35452
Protein Name Homeobox protein Hox-D12
Protein Accession # NP_067016
Purification Affinity Purified
Nucleotide Accession # NM_021193
Tested Species Reactivity Human
Gene Symbol HOXD12
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 85%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 82%; Zebrafish: 86%
Image 1
Human COLO205
WB Suggested Anti-HOXD12 Antibody Titration: 0.2-1 ug/ml
Positive Control: COLO205 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com