Product Number |
ARP58025_P050 |
Product Page |
www.avivasysbio.com/hoxd12-antibody-middle-region-arp58025-p050.html |
Name |
HOXD12 Antibody - middle region (ARP58025_P050) |
Protein Size (# AA) |
279 amino acids |
Molecular Weight |
30kDa |
NCBI Gene Id |
3238 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Homeobox D12 |
Alias Symbols |
HOX4H |
Peptide Sequence |
Synthetic peptide located within the following region: AELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKRVVLRE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
0 |
Description of Target |
HOXD12 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, |
Protein Interactions |
TRAF1; CREBBP; MAFF; MAFG; MEIS1; MAFB; MAFK; MAF; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-HOXD12 (ARP58025_P050) antibody |
Blocking Peptide |
For anti-HOXD12 (ARP58025_P050) antibody is Catalog # AAP58025 (Previous Catalog # AAPP32448) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human HOXD12 |
Uniprot ID |
P35452 |
Protein Name |
Homeobox protein Hox-D12 |
Protein Accession # |
NP_067016 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_021193 |
Tested Species Reactivity |
Human |
Gene Symbol |
HOXD12 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 85%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 82%; Zebrafish: 86% |
Image 1 | Human COLO205
| WB Suggested Anti-HOXD12 Antibody Titration: 0.2-1 ug/ml Positive Control: COLO205 cell lysate |
|
|