HOXB5 Antibody - N-terminal region (ARP58022_P050)

• Product Number: ARP58022_P050
• Name: HOXB5 Antibody - N-terminal region (ARP58022_P050)
• Protein Size (# AA): 269 amino acids
• Molecular Weight: 29kDa
• NCBI Gene Id: 3215
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Homeobox B5
• Alias Symbols: HOX2, HU-1, HOX2A, Hox2.1, HHO.C10
• Peptide Sequence: Synthetic peptide located within the following region: DPAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVGESSRAFPAPAQEPRF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Wu,Q., (er) Mol. Cancer 6, 45 (2007)
• Description of Target: HOXB5 belongs to ANTP homeobox family. It is a nuclear protein with a homeobox DNA-binding domain. HOXB5 gene is included in a cluster of homeobox B genes located on chromosome 17.The protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue.This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: MAGEA11; CTBP2; CTBP1; TRIM23; UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HOXB5 (ARP58022_P050) antibody is Catalog # AAP58022 (Previous Catalog # AAPP32445)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB5
• Uniprot ID: P09067
• Protein Name: Homeobox protein Hox-B5
• Protein Accession #: NP_002138
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002147
• Tested Species Reactivity: Human
• Gene Symbol: HOXB5
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-HOXB5 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: HepG2 cell lysate